Lineage for d1qtqa1 (1qtq A:339-547)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061452Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 2061453Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) (S)
  5. 2061515Family b.53.1.2: Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50719] (1 protein)
    automatically mapped to Pfam PF03950
  6. 2061516Protein Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50720] (2 species)
    duplication, consists of two barrel domains with the swapping of N-terminal strands
  7. 2061519Species Escherichia coli [TaxId:562] [50721] (17 PDB entries)
  8. 2061520Domain d1qtqa1: 1qtq A:339-547 [26940]
    Other proteins in same PDB: d1qtqa2
    protein/RNA complex; complexed with qsi, so4

Details for d1qtqa1

PDB Entry: 1qtq (more details), 2.25 Å

PDB Description: glutaminyl-trna synthetase complexed with trna and an amino acid analog
PDB Compounds: (A:) protein (glutaminyl-tRNA synthetase)

SCOPe Domain Sequences for d1qtqa1:

Sequence, based on SEQRES records: (download)

>d1qtqa1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli [TaxId: 562]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlskdpadgrkvkgvihw
vsaahalpveirlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqf
eregyfcldsrhstaekpvfnrtvglrdt

Sequence, based on observed residues (ATOM records): (download)

>d1qtqa1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli [TaxId: 562]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlgvihwvsaahalpvei
rlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsr
hstaekpvfnrtvglrdt

SCOPe Domain Coordinates for d1qtqa1:

Click to download the PDB-style file with coordinates for d1qtqa1.
(The format of our PDB-style files is described here.)

Timeline for d1qtqa1: