Lineage for d4u82a_ (4u82 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919043Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 2919044Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 2919045Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
    automatically mapped to Pfam PF01255
  6. 2919088Protein automated matches [190121] (4 species)
    not a true protein
  7. 2919109Species Staphylococcus aureus [TaxId:158879] [194209] (2 PDB entries)
  8. 2919111Domain d4u82a_: 4u82 A: [269395]
    automated match to d4h8ea_
    complexed with fps, mg, so4

Details for d4u82a_

PDB Entry: 4u82 (more details), 1.66 Å

PDB Description: structure of s. aureus undecaprenyl diphosphate synthase in complex with fspp and sulfate
PDB Compounds: (A:) Isoprenyl transferase

SCOPe Domain Sequences for d4u82a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u82a_ c.101.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
ldssnipehiaiimdgngrwakkrkmprikghyegmqtikkitriasdigvkyltlyafs
tenwsrpesevnyimnlpvnflktflpelieknvkvetigftdklpkstieainnakekt
anntglklifainyggraelvhsiknmfdelhqqglnsdiidetyinnhlmtkdypdpel
lirtsgeqrisnfliwqvsysefifnqklwpdfdedelikcikiyqsrqrrfggls

SCOPe Domain Coordinates for d4u82a_:

Click to download the PDB-style file with coordinates for d4u82a_.
(The format of our PDB-style files is described here.)

Timeline for d4u82a_: