Lineage for d4s2nd_ (4s2n D:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2245342Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2245343Protein automated matches [190857] (40 species)
    not a true protein
  7. 2245564Species Klebsiella pneumoniae [TaxId:573] [225260] (23 PDB entries)
  8. 2245595Domain d4s2nd_: 4s2n D: [269390]
    automated match to d1nrfa_
    complexed with nxl

Details for d4s2nd_

PDB Entry: 4s2n (more details), 2 Å

PDB Description: oxa-48 in complex with avibactam at ph 8.5
PDB Compounds: (D:) Beta-lactamase

SCOPe Domain Sequences for d4s2nd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s2nd_ e.3.1.0 (D:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
ewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdl
gvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafd
ygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdy
iiraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqeki
ip

SCOPe Domain Coordinates for d4s2nd_:

Click to download the PDB-style file with coordinates for d4s2nd_.
(The format of our PDB-style files is described here.)

Timeline for d4s2nd_: