SCOPe 2.07: Domain d4s2na_: 4s2n A:

Lineage for d4s2na_ (4s2n A:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225260] (109 PDB entries)

8. Domain d4s2na_: 4s2n A: [269385]
   automated match to d1nrfa_
   complexed with nxl

Details for d4s2na_

PDB Entry: 4s2n, 2 Å

PDB Description: oxa-48 in complex with avibactam at ph 8.5

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d4s2na_:

Sequence; same for both SEQRES and ATOM records:

>d4s2na_ e.3.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
kewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnsliald
lgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhaf
dygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangd
yiiraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqek
iip

Timeline for d4s2na_:

• d4s2na_ first appeared in SCOPe 2.05
  
• d4s2na_ appears in SCOPe 2.06
  
• d4s2na_ appears in the current release, SCOPe 2.08