![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
![]() | Protein automated matches [190857] (31 species) not a true protein |
![]() | Species Klebsiella pneumoniae [TaxId:573] [225260] (11 PDB entries) |
![]() | Domain d4s2kb_: 4s2k B: [269382] automated match to d1nrfa_ complexed with nxl |
PDB Entry: 4s2k (more details), 2.1 Å
SCOPe Domain Sequences for d4s2kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4s2kb_ e.3.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]} vakewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslia ldlgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlh afdygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamltean gdyiiraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkq ekiip
Timeline for d4s2kb_: