Lineage for d4s2kc_ (4s2k C:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1950340Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 1950341Protein automated matches [190857] (31 species)
    not a true protein
  7. 1950465Species Klebsiella pneumoniae [TaxId:573] [225260] (11 PDB entries)
  8. 1950483Domain d4s2kc_: 4s2k C: [269380]
    automated match to d1nrfa_
    complexed with nxl

Details for d4s2kc_

PDB Entry: 4s2k (more details), 2.1 Å

PDB Description: oxa-48 in complex with avibactam at ph 7.5
PDB Compounds: (C:) Beta-lactamase

SCOPe Domain Sequences for d4s2kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s2kc_ e.3.1.0 (C:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
vakewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslia
ldlgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlh
afdygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamltean
gdyiiraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkq
ekiip

SCOPe Domain Coordinates for d4s2kc_:

Click to download the PDB-style file with coordinates for d4s2kc_.
(The format of our PDB-style files is described here.)

Timeline for d4s2kc_: