SCOPe 2.05: Domain d4s2ka_: 4s2k A:

Lineage for d4s2ka_ (4s2k A:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (31 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225260] (11 PDB entries)

8. Domain d4s2ka_: 4s2k A: [269379]
   automated match to d1nrfa_
   complexed with nxl

Details for d4s2ka_

PDB Entry: 4s2k, 2.1 Å

PDB Description: oxa-48 in complex with avibactam at ph 7.5

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d4s2ka_:

Sequence; same for both SEQRES and ATOM records:

>d4s2ka_ e.3.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
ewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdl
gvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafd
ygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdy
iiraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqeki
ip

Timeline for d4s2ka_:

• d4s2ka_ is new in SCOPe 2.05-stable
  
• d4s2ka_ appears in SCOPe 2.06
  
• d4s2ka_ appears in the current release, SCOPe 2.08