Lineage for d4s0tb_ (4s0t B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009172Protein Pregnane x receptor, PXR [63624] (1 species)
  7. 2009173Species Human (Homo sapiens) [TaxId:9606] [63625] (16 PDB entries)
  8. 2009192Domain d4s0tb_: 4s0t B: [269372]
    Other proteins in same PDB: d4s0td_, d4s0te_
    automated match to d1m13a_
    complexed with 40u

Details for d4s0tb_

PDB Entry: 4s0t (more details), 3.14 Å

PDB Description: structure of human pregnane x receptor ligand binding domain bound with adnectin-1 and compound-1
PDB Compounds: (B:) Nuclear receptor subfamily 1 group I member 2

SCOPe Domain Sequences for d4s0tb_:

Sequence, based on SEQRES records: (download)

>d4s0tb_ a.123.1.1 (B:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]}
glteeqrmmirelmdaqmktfdttfshfknfrlpgvlssgcelpeslqapsreeaakwsq
vrkdlcslkvslqlrgedgsvwnykppadsggkeifsllphmadmstymfkgiisfakvi
syfrdlpiedqisllkgaafelcqlrfntvfnaetgtwecgrlsycledtaggfqqllle
pmlkfhymlkklqlheeeyvlmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnr
pqpahrflflkimamltelrsinaqhtqrllriqdihpfatplmqelfgi

Sequence, based on observed residues (ATOM records): (download)

>d4s0tb_ a.123.1.1 (B:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]}
glteeqrmmirelmdaqmktfdttfshfknfrlpgvleslqapsreeaakwsqvrkdlcs
lkvslqlrgedgsvwnykppadsggkeifsllphmadmstymfkgiisfakvisyfrdlp
iedqisllkgaafelcqlrfntvfnaetgtwecgrlsycledtaggfqqlllepmlkfhy
mlkklqlheeeyvlmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnrpqpahrf
lflkimamltelrsinaqhtqrllriqdihpfatplmqelfgi

SCOPe Domain Coordinates for d4s0tb_:

Click to download the PDB-style file with coordinates for d4s0tb_.
(The format of our PDB-style files is described here.)

Timeline for d4s0tb_: