Lineage for d4s0te_ (4s0t E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1767525Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1768056Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 1768057Protein automated matches [190976] (4 species)
    not a true protein
  7. 1768081Species Human (Homo sapiens) [TaxId:9606] [188649] (36 PDB entries)
  8. 1768125Domain d4s0te_: 4s0t E: [269369]
    Other proteins in same PDB: d4s0ta_, d4s0tb_
    automated match to d4ov6f_
    complexed with 40u

Details for d4s0te_

PDB Entry: 4s0t (more details), 3.14 Å

PDB Description: structure of human pregnane x receptor ligand binding domain bound with adnectin-1 and compound-1
PDB Compounds: (E:) Adnectin-1

SCOPe Domain Sequences for d4s0te_:

Sequence, based on SEQRES records: (download)

>d4s0te_ b.1.2.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adlevvaatptslliswpppyyvegvtvfritygetggnspvqeftvpywtetatisglk
pgvdytitvyaemypgspwagqvmdiqpisinyrt

Sequence, based on observed residues (ATOM records): (download)

>d4s0te_ b.1.2.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adlevvaatptslliswpppyyvegvtvfritygetggnspvqeftvpywtetatisglk
pgvdytitvyaemypgspwmdiqpisinyrt

SCOPe Domain Coordinates for d4s0te_:

Click to download the PDB-style file with coordinates for d4s0te_.
(The format of our PDB-style files is described here.)

Timeline for d4s0te_: