SCOPe 2.08: Domain d4s0te_: 4s0t E:

Lineage for d4s0te_ (4s0t E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)

8. Domain d4s0te_: 4s0t E: [269369]
   Other proteins in same PDB: d4s0ta_, d4s0tb_
   automated match to d4ov6f_
   complexed with 40u

Details for d4s0te_

PDB Entry: 4s0t, 3.14 Å

PDB Description: structure of human pregnane x receptor ligand binding domain bound with adnectin-1 and compound-1

PDB Compounds: (E:) Adnectin-1

SCOPe Domain Sequences for d4s0te_:

Sequence, based on SEQRES records:

>d4s0te_ b.1.2.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adlevvaatptslliswpppyyvegvtvfritygetggnspvqeftvpywtetatisglk
pgvdytitvyaemypgspwagqvmdiqpisinyrt

Sequence, based on observed residues (ATOM records):

>d4s0te_ b.1.2.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adlevvaatptslliswpppyyvegvtvfritygetggnspvqeftvpywtetatisglk
pgvdytitvyaemypgspwmdiqpisinyrt

Timeline for d4s0te_:

• d4s0te_ first appeared in SCOPe 2.05
  
• d4s0te_ appears in SCOPe 2.07