Lineage for d4rwsc_ (4rws C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890825Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1890826Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1890827Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 1891108Protein automated matches [190403] (3 species)
    not a true protein
  7. 1891147Species Human herpesvirus 8 strain gk18 [TaxId:868565] [269363] (1 PDB entry)
  8. 1891148Domain d4rwsc_: 4rws C: [269364]
    automated match to d1hhva_

Details for d4rwsc_

PDB Entry: 4rws (more details), 3.1 Å

PDB Description: crystal structure of cxcr4 and viral chemokine antagonist vmip-ii complex (psi community target)
PDB Compounds: (C:) Viral macrophage inflammatory protein 2

SCOPe Domain Sequences for d4rwsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rwsc_ d.9.1.1 (C:) automated matches {Human herpesvirus 8 strain gk18 [TaxId: 868565]}
lgaschrpdkcclgyqkrplpqvllsswyptsqlcskpgvifltkrgrqvcadkskdwvk
klmqqlpvta

SCOPe Domain Coordinates for d4rwsc_:

Click to download the PDB-style file with coordinates for d4rwsc_.
(The format of our PDB-style files is described here.)

Timeline for d4rwsc_: