Lineage for d4rg8a_ (4rg8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124881Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2124882Protein automated matches [190396] (34 species)
    not a true protein
  7. 2125063Species Methylocaldum szegediense [TaxId:73780] [269348] (1 PDB entry)
  8. 2125064Domain d4rg8a_: 4rg8 A: [269349]
    automated match to d3hp9a_
    complexed with mg

Details for d4rg8a_

PDB Entry: 4rg8 (more details), 2.12 Å

PDB Description: structural and biochemical studies of a moderately thermophilic exonuclease i from methylocaldum szegediense
PDB Compounds: (A:) exonuclease I

SCOPe Domain Sequences for d4rg8a_:

Sequence, based on SEQRES records: (download)

>d4rg8a_ c.55.3.0 (A:) automated matches {Methylocaldum szegediense [TaxId: 73780]}
ccslywydyetfgtdprrdrpaqfagirtdlelnpigepvtlfckpardvlpvpeaclit
gitpqmaaerglkeaefitriheqfsvpgtcvagynnirfddevtrhclyrnlfdpyere
wrngnsrwdiidmlrltralrpegiewpvdgsgkpslrlealtvangiqhenahdaladv
ratiavarlvrerqpklfnfvfanrgkreafellrfgamqpvlhvsekyasdryclavvv
alarhprnpngvvvydlsvdptplidlnaedlrerlftpasklppgverialktvhlnkc
pviapltalrsqdterlqidldrcnrhldrlkrewtlpkkireamtyngpetdtddpdlm
lydgflgdadravlkwlrgltpdelaraqpsfedarlpellfryrarnfpetltpeetar
weayrirrltvegcggsivlneylariealeaspdlsakdreilknlreyareiis

Sequence, based on observed residues (ATOM records): (download)

>d4rg8a_ c.55.3.0 (A:) automated matches {Methylocaldum szegediense [TaxId: 73780]}
ccslywydyetfgtdprrdrpaqfagirtdlelnpigepvtlfckpardvlpvpeaclit
gitpqmaaerglkeaefitriheqfsvpgtcvagynnirfddevtrhclyrnlfdpyere
wrngnsrwdiidmlrltralrpegiewpvdgsgkpslrlealtvangiqhahdaladvra
tiavarlvrerqpklfnfvfanrgkreafellrfgamqpvlhvsekyasdryclavvval
arhprnpngvvvydlsvdptplidlnaedlrerlftpasklppgverialktvhlnkcpv
iapltalrsqdterlqidldrcnrhldrlkrewtlpkkireamttddpdlmlydgflgda
dravlkwlrgltpdelaraqpsfedarlpellfryrarnfpetltpeetarweayrirrl
tvegcggsivlneylariealeaspdlsakdreilknlreyareiis

SCOPe Domain Coordinates for d4rg8a_:

Click to download the PDB-style file with coordinates for d4rg8a_.
(The format of our PDB-style files is described here.)

Timeline for d4rg8a_: