Lineage for d4rdya_ (4rdy A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096081Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2096704Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2096705Protein automated matches [190150] (26 species)
    not a true protein
  7. 2096909Species Vulcanisaeta moutnovskia [TaxId:985053] [269342] (3 PDB entries)
  8. 2096912Domain d4rdya_: 4rdy A: [269346]
    automated match to d4g2da_
    complexed with 3m5, co, gol, so4

Details for d4rdya_

PDB Entry: 4rdy (more details), 2 Å

PDB Description: Crystal structure of VmoLac bound to 3-oxo-C10 AHL
PDB Compounds: (A:) Parathion hydrolase

SCOPe Domain Sequences for d4rdya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rdya_ c.1.9.0 (A:) automated matches {Vulcanisaeta moutnovskia [TaxId: 985053]}
vrisiaggneidpgsmgltlfhehlrlitevvrwnwphlynedeelkraidavnaakkyg
vktiidltvagigcdvrfnekvakatgvniimgtgfytyteipfyfknrgidslvdafvh
ditigiqgtntraafvkavidssgltkdvemairaaakahiktdvpiithsfvgnkssld
lirifkeegvdlartvighvgdtddisfieqilregafigldrfgldiylpldkrvktai
elikrgwidqlllshdycptidwyppevvrstvpdwtmtlifekviprmrsegiteeqin
rvlidnprrlftg

SCOPe Domain Coordinates for d4rdya_:

Click to download the PDB-style file with coordinates for d4rdya_.
(The format of our PDB-style files is described here.)

Timeline for d4rdya_: