Lineage for d1cz4a1 (1cz4 A:1-91)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412093Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2412166Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2412311Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins)
  6. 2412367Protein N-terminal domain of VAT-N, VAT-Nn [50712] (1 species)
    VAT-N is the N-terminal 'functional' domain of the VCP-like ATPase
  7. 2412368Species Thermoplasma acidophilum [TaxId:2303] [50713] (2 PDB entries)
  8. 2412370Domain d1cz4a1: 1cz4 A:1-91 [26934]
    Other proteins in same PDB: d1cz4a2

Details for d1cz4a1

PDB Entry: 1cz4 (more details)

PDB Description: nmr structure of vat-n: the n-terminal domain of vat (vcp-like atpase of thermoplasma)
PDB Compounds: (A:) vcp-like ATPase

SCOPe Domain Sequences for d1cz4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cz4a1 b.52.2.3 (A:1-91) N-terminal domain of VAT-N, VAT-Nn {Thermoplasma acidophilum [TaxId: 2303]}
mesnngiilrvaeanstdpgmsrvrldessrrlldaeigdvveiekvrktvgrvyrarpe
denkgivridsvmrnncgasigdkvkvrkvr

SCOPe Domain Coordinates for d1cz4a1:

Click to download the PDB-style file with coordinates for d1cz4a1.
(The format of our PDB-style files is described here.)

Timeline for d1cz4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cz4a2