SCOPe 2.06: Domain d1cz4a1: 1cz4 A:1-91

Lineage for d1cz4a1 (1cz4 A:1-91)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins)

6. Protein N-terminal domain of VAT-N, VAT-Nn [50712] (1 species)
   VAT-N is the N-terminal 'functional' domain of the VCP-like ATPase

7. Species Thermoplasma acidophilum [TaxId:2303] [50713] (2 PDB entries)

8. Domain d1cz4a1: 1cz4 A:1-91 [26934]
   Other proteins in same PDB: d1cz4a2

Details for d1cz4a1

PDB Entry: 1cz4

PDB Description: nmr structure of vat-n: the n-terminal domain of vat (vcp-like atpase of thermoplasma)

PDB Compounds: (A:) vcp-like ATPase

SCOPe Domain Sequences for d1cz4a1:

Sequence; same for both SEQRES and ATOM records:

>d1cz4a1 b.52.2.3 (A:1-91) N-terminal domain of VAT-N, VAT-Nn {Thermoplasma acidophilum [TaxId: 2303]}
mesnngiilrvaeanstdpgmsrvrldessrrlldaeigdvveiekvrktvgrvyrarpe
denkgivridsvmrnncgasigdkvkvrkvr

Timeline for d1cz4a1:

• d1cz4a1 first appeared (with stable ids) in SCOP 1.55
  
• d1cz4a1 appears in SCOPe 2.05
  
• d1cz4a1 appears in SCOPe 2.07
  
• d1cz4a1 appears in the current release, SCOPe 2.08