SCOPe 2.08: Domain d4qthb2: 4qth B:108-211

Lineage for d4qthb2 (4qth B:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4qthb2: 4qth B:108-211 [269337]
   Other proteins in same PDB: d4qtha1, d4qtha2, d4qthb1, d4qthh1, d4qthh2, d4qthl1
   automated match to d1h3pl2

Details for d4qthb2

PDB Entry: 4qth, 2.17 Å

PDB Description: crystal structure of anti-upar fab 8b12

PDB Compounds: (B:) anti-uPAR antibody, light chain

SCOPe Domain Sequences for d4qthb2:

Sequence; same for both SEQRES and ATOM records:

>d4qthb2 b.1.1.2 (B:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d4qthb2:

• d4qthb2 first appeared in SCOPe 2.05
  
• d4qthb2 appears in SCOPe 2.07