SCOPe 2.05: Domain d4qvbb_: 4qvb B:

Lineage for d4qvbb_ (4qvb B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein automated matches [190383] (5 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1138877] [269332] (1 PDB entry)

8. Domain d4qvbb_: 4qvb B: [269333]
   automated match to d1w9ab_
   complexed with edo, f42, fmt, na, pdo, pgo

Details for d4qvbb_

PDB Entry: 4qvb, 2.3 Å

PDB Description: mycobacterium tuberculosis protein rv1155 in complex with co-enzyme f420

PDB Compounds: (B:) Rv1155 protein

SCOPe Domain Sequences for d4qvbb_:

Sequence; same for both SEQRES and ATOM records:

>d4qvbb_ b.45.1.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1138877]}
qvfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrr
dprasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqa
mvtdrrvlltlpishvyglppgmr

Timeline for d4qvbb_:

• d4qvbb_ is new in SCOPe 2.05-stable
  
• d4qvbb_ appears in SCOPe 2.06
  
• d4qvbb_ appears in the current release, SCOPe 2.08