Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries) |
Domain d4qnpl2: 4qnp L:110-211 [269331] Other proteins in same PDB: d4qnpa_, d4qnpb_, d4qnpf1, d4qnpl1 automated match to d3oz9l2 complexed with ca, nag |
PDB Entry: 4qnp (more details), 2.8 Å
SCOPe Domain Sequences for d4qnpl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qnpl2 b.1.1.2 (L:110-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]} aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd stysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d4qnpl2:
View in 3D Domains from other chains: (mouse over for more information) d4qnpa_, d4qnpb_, d4qnpf1, d4qnpf2 |