SCOP 1.55: Domain d1cr5c1: 1cr5 C:26-107

Lineage for d1cr5c1 (1cr5 C:26-107)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)

4. Superfamily b.52.2: ADC-like [50692] (3 families)

5. Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (2 proteins)

6. Protein N-terminal domain of NSF-N, NSF-Nn [50709] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId:4932] [50711] (1 PDB entry)

8. Domain d1cr5c1: 1cr5 C:26-107 [26933]
   Other proteins in same PDB: d1cr5a2, d1cr5b2, d1cr5c2

Details for d1cr5c1

PDB Entry: 1cr5, 2.3 Å

PDB Description: n-terminal domain of sec18p

SCOP Domain Sequences for d1cr5c1:

Sequence; same for both SEQRES and ATOM records:

>d1cr5c1 b.52.2.3 (C:26-107) N-terminal domain of NSF-N, NSF-Nn {Baker's yeast (Saccharomyces cerevisiae), sec18p}
trhlkvsncpnnsyalanvaavspndfpnniyiiidnlfvfttrhsndippgtigfngnq
rtwggwslnqdvqakafdlfky

Timeline for d1cr5c1:

• d1cr5c1 appears in SCOP 1.57
  
• d1cr5c1 appears in the current release, SCOPe 2.08