Lineage for d4qtiu1 (4qti U:1-80)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2583547Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2583548Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2583778Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 2583851Protein Urokinase plasminogen activator surface receptor uPAR [161128] (1 species)
    duplication: tandem repeat of three similar domains; the N-terminal and C-terminal domains belong to Pfam PF00021; uPAR/Ly6
  7. 2583852Species Human (Homo sapiens) [TaxId:9606] [161129] (6 PDB entries)
    Uniprot Q03405 109-209! Uniprot Q03405 210-299! Uniprot Q03405 23-108
  8. 2583898Domain d4qtiu1: 4qti U:1-80 [269327]
    Other proteins in same PDB: d4qtil1, d4qtil2
    automated match to d2i9be2

Details for d4qtiu1

PDB Entry: 4qti (more details), 3 Å

PDB Description: Crystal structure of human uPAR in complex with anti-uPAR Fab 8B12
PDB Compounds: (U:) Urokinase plasminogen activator surface receptor

SCOPe Domain Sequences for d4qtiu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qtiu1 g.7.1.3 (U:1-80) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
lrcmqcktngdcrveecalgqdlcrttivrlweegeelelvekscthsektnrtlsyrtg
lkitsltevvcgldlcnqgn

SCOPe Domain Coordinates for d4qtiu1:

Click to download the PDB-style file with coordinates for d4qtiu1.
(The format of our PDB-style files is described here.)

Timeline for d4qtiu1: