Lineage for d4qnpf2 (4qnp F:110-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752990Domain d4qnpf2: 4qnp F:110-212 [269326]
    Other proteins in same PDB: d4qnpa_, d4qnpb_, d4qnpe_, d4qnpf1, d4qnph_, d4qnpl1
    automated match to d3oz9l2
    complexed with ca, nag

Details for d4qnpf2

PDB Entry: 4qnp (more details), 2.8 Å

PDB Description: crystal structure of the 2009 pandemic h1n1 influenza virus neuraminidase with a neutralizing antibody
PDB Compounds: (F:) neutralizing antibody, light chain

SCOPe Domain Sequences for d4qnpf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qnpf2 b.1.1.2 (F:110-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d4qnpf2:

Click to download the PDB-style file with coordinates for d4qnpf2.
(The format of our PDB-style files is described here.)

Timeline for d4qnpf2: