SCOPe 2.05: Domain d4qrhc_: 4qrh C:

Lineage for d4qrhc_ (4qrh C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1458279] [269318] (1 PDB entry)

8. Domain d4qrhc_: 4qrh C: [269321]
   automated match to d2j41d_
   complexed with 0o2, edo, k, mg, so4

Details for d4qrhc_

PDB Entry: 4qrh, 1.65 Å

PDB Description: molecular mechanism and evolution of guanylate kinase regulation by (p)ppgpp

PDB Compounds: (C:) Guanylate kinase

SCOPe Domain Sequences for d4qrhc_:

Sequence, based on SEQRES records:

>d4qrhc_ c.37.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1458279]}
nekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrda
fealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfi
flappslehlrerlvgrgtesdekiqsrinearkevemmnlydyvvvndevelaknriqc
iveaehlkrerveakyrkmilea

Sequence, based on observed residues (ATOM records):

>d4qrhc_ c.37.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1458279]}
nekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrda
fealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfi
flappslehlinearkevemmnlydyvvvndevelaknriqciveaehlkrerveakyrk
milea

Timeline for d4qrhc_:

• d4qrhc_ is new in SCOPe 2.05-stable
  
• d4qrhc_ appears in SCOPe 2.06
  
• d4qrhc_ appears in the current release, SCOPe 2.08