Lineage for d4qrhc_ (4qrh C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114670Species Staphylococcus aureus [TaxId:1458279] [269318] (1 PDB entry)
  8. 2114673Domain d4qrhc_: 4qrh C: [269321]
    automated match to d2j41d_
    complexed with 0o2, edo, k, mg, so4

Details for d4qrhc_

PDB Entry: 4qrh (more details), 1.65 Å

PDB Description: molecular mechanism and evolution of guanylate kinase regulation by (p)ppgpp
PDB Compounds: (C:) Guanylate kinase

SCOPe Domain Sequences for d4qrhc_:

Sequence, based on SEQRES records: (download)

>d4qrhc_ c.37.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1458279]}
nekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrda
fealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfi
flappslehlrerlvgrgtesdekiqsrinearkevemmnlydyvvvndevelaknriqc
iveaehlkrerveakyrkmilea

Sequence, based on observed residues (ATOM records): (download)

>d4qrhc_ c.37.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1458279]}
nekgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrda
fealikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfi
flappslehlinearkevemmnlydyvvvndevelaknriqciveaehlkrerveakyrk
milea

SCOPe Domain Coordinates for d4qrhc_:

Click to download the PDB-style file with coordinates for d4qrhc_.
(The format of our PDB-style files is described here.)

Timeline for d4qrhc_: