Lineage for d4qlxa_ (4qlx A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963435Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2963436Protein automated matches [190672] (32 species)
    not a true protein
  7. 2963502Species Lactobacillus plantarum [TaxId:1590] [269281] (2 PDB entries)
  8. 2963503Domain d4qlxa_: 4qlx A: [269288]
    automated match to d3gbha_
    complexed with cl, fmn, ktc

Details for d4qlxa_

PDB Entry: 4qlx (more details), 1.95 Å

PDB Description: crystal structure of cla-er with product binding
PDB Compounds: (A:) Nitroreductase family protein

SCOPe Domain Sequences for d4qlxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qlxa_ d.90.1.0 (A:) automated matches {Lactobacillus plantarum [TaxId: 1590]}
mseavknlvnndladvmfnrhsvrqfdpnvkigrdelqkmiaeaatapsacnlqswhfvv
vdtpeakakfkqavmkfnypqvdsasaivfiagdtqshyvyrdvwnkvyedgnitkerld
qilgtflplyenatpdflkfdatidcsvvgmqlllvarahgydanafsgidfekmiptlg
ldpkryvpvmgiaigkaaqeplhttrydaktqtdfla

SCOPe Domain Coordinates for d4qlxa_:

Click to download the PDB-style file with coordinates for d4qlxa_.
(The format of our PDB-style files is described here.)

Timeline for d4qlxa_: