SCOPe 2.08: Domain d4qlxa_: 4qlx A:

Lineage for d4qlxa_ (4qlx A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
   core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243

4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families)

5. Family d.90.1.0: automated matches [191446] (1 protein)
   not a true family

6. Protein automated matches [190672] (32 species)
   not a true protein

7. Species Lactobacillus plantarum [TaxId:1590] [269281] (2 PDB entries)

8. Domain d4qlxa_: 4qlx A: [269288]
   automated match to d3gbha_
   complexed with cl, fmn, ktc

Details for d4qlxa_

PDB Entry: 4qlx, 1.95 Å

PDB Description: crystal structure of cla-er with product binding

PDB Compounds: (A:) Nitroreductase family protein

SCOPe Domain Sequences for d4qlxa_:

Sequence; same for both SEQRES and ATOM records:

>d4qlxa_ d.90.1.0 (A:) automated matches {Lactobacillus plantarum [TaxId: 1590]}
mseavknlvnndladvmfnrhsvrqfdpnvkigrdelqkmiaeaatapsacnlqswhfvv
vdtpeakakfkqavmkfnypqvdsasaivfiagdtqshyvyrdvwnkvyedgnitkerld
qilgtflplyenatpdflkfdatidcsvvgmqlllvarahgydanafsgidfekmiptlg
ldpkryvpvmgiaigkaaqeplhttrydaktqtdfla

Timeline for d4qlxa_:

• d4qlxa_ first appeared in SCOPe 2.05
  
• d4qlxa_ appears in SCOPe 2.07