![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
![]() | Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) ![]() |
![]() | Family d.90.1.0: automated matches [191446] (1 protein) not a true family |
![]() | Protein automated matches [190672] (32 species) not a true protein |
![]() | Species Lactobacillus plantarum [TaxId:1590] [269281] (2 PDB entries) |
![]() | Domain d4qlyc_: 4qly C: [269286] automated match to d3gbha_ complexed with fmn |
PDB Entry: 4qly (more details), 2 Å
SCOPe Domain Sequences for d4qlyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qlyc_ d.90.1.0 (C:) automated matches {Lactobacillus plantarum [TaxId: 1590]} lvnndladvmfnrhsvrqfdpnvkigrdelqkmiaeaatapsacnlqswhfvvvdtpeak akfkqavmkfnypqvdsasaivfiagdtqshyvyrdvwnkvyedgnitkerldqilgtfl plyenatpdflkfdatidcsvvgmqlllvarahgydanafsgidfekmiptlgldpkryv pvmgiaigkaaqeplhttrydaktqtdfla
Timeline for d4qlyc_: