![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
![]() | Superfamily b.52.2: ADC-like [50692] (4 families) ![]() |
![]() | Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins) |
![]() | Protein N-terminal domain of NSF-N, NSF-Nn [50709] (2 species) NSF-N, the N-terminal 'functional' domain of the N-ethylmaleimide sensitive fusion protein, consists of two structural domains |
![]() | Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [50710] (2 PDB entries) |
![]() | Domain d1qdna1: 1qdn A:1-85 [26928] Other proteins in same PDB: d1qdna2, d1qdnb2, d1qdnc2 complexed with bme, so4 |
PDB Entry: 1qdn (more details), 2.3 Å
SCOPe Domain Sequences for d1qdna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qdna1 b.52.2.3 (A:1-85) N-terminal domain of NSF-N, NSF-Nn {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} magrsmqaarcptdelslsncavvsekdyqsgqhvivrtspnhkyiftlrthpsvvpgsv afslpqrkwaglsigqeievalysf
Timeline for d1qdna1:
![]() Domains from other chains: (mouse over for more information) d1qdnb1, d1qdnb2, d1qdnc1, d1qdnc2 |