Lineage for d4pphe_ (4pph E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2393810Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2393811Protein automated matches [190954] (11 species)
    not a true protein
  7. 2393865Species Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId:3871] [269263] (1 PDB entry)
  8. 2393870Domain d4pphe_: 4pph E: [269269]
    automated match to d3aupa_
    complexed with edo, fuc, nag

Details for d4pphe_

PDB Entry: 4pph (more details), 2.01 Å

PDB Description: crystal structure of conglutin gamma, a unique basic 7s globulin from lupine seeds
PDB Compounds: (E:) Conglutin gamma

SCOPe Domain Sequences for d4pphe_:

Sequence, based on SEQRES records: (download)

>d4pphe_ b.50.1.0 (E:) automated matches {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]}
kpnllvlpvqedastglhwanihkrtplmqvpllldlngkhlwvtcsqhyssstyqapfc
hstqcsranthqcftctdstttrpgchnntcgllssnpvtqesglgelaqdvlaihsthg
sklgpmvkvpqflfscapsflaqkglpnnvqgalglgqapislqnqlfshfglkrqfsvc
lsrystsngailfgdindpnnnnyihnsldvlhdlvytpltiskqgeyfiqvnairvnkh
lviptknpfispsstsyhgsgeiggalittthpytvlshsifevftqvfannmpkqaqvk
avgpfglcydsrkisggapsvdlildkndavwrissenfmvqaqdgvsclgfvdggvhar
agialgahhleenlvvfdlersrvgfnsnslksygktcsnlfdlnn

Sequence, based on observed residues (ATOM records): (download)

>d4pphe_ b.50.1.0 (E:) automated matches {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]}
kpnllvlpvqedastglhwanihkrtplmqvpllldlngkhlwvtcsqhyssstyqapfc
hstqcsranthqcftctdstttrpgchnntcgllssnpvtqesglgelaqdvlaihsthg
sklgpmvkvpqflfscapsflaqkglpnnvqgalglgqapislqnqlfshfglkrqfsvc
lsrystsngailfgdindpnnnnyihnsldvlhdlvytpltiskqgeyfiqvnairvnkh
lviptgeiggalittthpytvlshsifevftqvfannmpkqaqvkavgpfglcydsrkis
ggapsvdlildkndavwrissenfmvqaqdgvsclgfvdggvharagialgahhleenlv
vfdlersrvgfnsnslksygktcsnlfdlnn

SCOPe Domain Coordinates for d4pphe_:

Click to download the PDB-style file with coordinates for d4pphe_.
(The format of our PDB-style files is described here.)

Timeline for d4pphe_: