Lineage for d4pphd_ (4pph D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2061036Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2061037Protein automated matches [190954] (10 species)
    not a true protein
  7. 2061089Species Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId:3871] [269263] (1 PDB entry)
  8. 2061093Domain d4pphd_: 4pph D: [269267]
    automated match to d3aupa_
    complexed with edo, nag

Details for d4pphd_

PDB Entry: 4pph (more details), 2.01 Å

PDB Description: crystal structure of conglutin gamma, a unique basic 7s globulin from lupine seeds
PDB Compounds: (D:) Conglutin gamma

SCOPe Domain Sequences for d4pphd_:

Sequence, based on SEQRES records: (download)

>d4pphd_ b.50.1.0 (D:) automated matches {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]}
skpnllvlpvqedastglhwanihkrtplmqvpllldlngkhlwvtcsqhyssstyqapf
chstqcsranthqcftctdstttrpgchnntcgllssnpvtqesglgelaqdvlaihsth
gsklgpmvkvpqflfscapsflaqkglpnnvqgalglgqapislqnqlfshfglkrqfsv
clsrystsngailfgdindpnnnnyihnsldvlhdlvytpltiskqgeyfiqvnairvnk
hlviptknpfispsstsyhgsgeiggalittthpytvlshsifevftqvfannmpkqaqv
kavgpfglcydsrkisggapsvdlildkndavwrissenfmvqaqdgvsclgfvdggvha
ragialgahhleenlvvfdlersrvgfnsnslksygktcsnlfdlnnp

Sequence, based on observed residues (ATOM records): (download)

>d4pphd_ b.50.1.0 (D:) automated matches {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]}
skpnllvlpvqedastglhwanihkrtplmqvpllldlngkhlwvtcsqhyssstyqapf
chstqcsranthqcftctdstttrpgchnntcgllssnpvtqesglgelaqdvlaihsth
gsklgpmvkvpqflfscapsflaqkglpnnvqgalglgqapislqnqlfshfglkrqfsv
clsrystsngailfgdindpnnnnyihnsldvlhdlvytpltiskqgeyfiqvnairvnk
hlvipteiggalittthpytvlshsifevftqvfannmpkqaqvkavgpfglcydsrkis
ggapsvdlildkndavwrissenfmvqaqdgvsclgfvdggvharagialgahhleenlv
vfdlersrvgfnsnslksygktcsnlfdlnnp

SCOPe Domain Coordinates for d4pphd_:

Click to download the PDB-style file with coordinates for d4pphd_.
(The format of our PDB-style files is described here.)

Timeline for d4pphd_: