Lineage for d2napa1 (2nap A:601-723)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412093Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2412166Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2412197Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 2412240Protein Periplasmic nitrate reductase alpha chain, NapA [50706] (2 species)
  7. Species Desulfovibrio desulfuricans [TaxId:876] [50707] (5 PDB entries)
    dissimilatory nitrate reductase (NAP)
  8. 2412242Domain d2napa1: 2nap A:601-723 [26926]
    Other proteins in same PDB: d2napa2
    complexed with mes, mgd, mo, sf4

Details for d2napa1

PDB Entry: 2nap (more details), 1.9 Å

PDB Description: dissimilatory nitrate reductase (nap) from desulfovibrio desulfuricans
PDB Compounds: (A:) protein (periplasmic nitrate reductase)

SCOPe Domain Sequences for d2napa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2napa1 b.52.2.2 (A:601-723) Periplasmic nitrate reductase alpha chain, NapA {Desulfovibrio desulfuricans [TaxId: 876]}
aaeepdaeyplyltsmrvidhwhtatmtgkvpelqkanpiafveineedaartgikhgds
vivetrrdamelparvsdvcrpgliavpffdpkklvnklfldatdpvsrepeykicaarv
rka

SCOPe Domain Coordinates for d2napa1:

Click to download the PDB-style file with coordinates for d2napa1.
(The format of our PDB-style files is described here.)

Timeline for d2napa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2napa2