SCOPe 2.06: Domain d4p1la_: 4p1l A:

Lineage for d4p1la_ (4p1l A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Chromohalobacter salexigens [TaxId:290398] [267970] (3 PDB entries)

8. Domain d4p1la_: 4p1l A: [269257]
   automated match to d2hpga_
   complexed with bdp, gol, so4

Details for d4p1la_

PDB Entry: 4p1l, 1.7 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound d-glucuronate, spg i213

PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4p1la_:

Sequence; same for both SEQRES and ATOM records:

>d4p1la_ c.94.1.0 (A:) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
swrgwnihppsypngkalesfakevaektegrvepkvyhnavlgdqpdaieqtrsgaldf
anfnmgpmgpivpaanvlslpfifkspddmyrimdgeigerfadalaeknlivlswfgsg
arslyntdhpvetpddveglkvrvmnndlyvqmidemggnatpmaygevyqslktgvidg
aennypsyessghyevanyysltehlilpeclcvakasweelsekdrqaireaaedaake
qralweegvqaskqkildagvkinevddksafqakmqpiydqfvqehpeleslvtdiqda
qs

Timeline for d4p1la_:

• d4p1la_ first appeared in SCOPe 2.05
  
• d4p1la_ appears in SCOPe 2.07
  
• d4p1la_ appears in the current release, SCOPe 2.08