Lineage for d4p1la_ (4p1l A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915397Species Chromohalobacter salexigens [TaxId:290398] [267970] (3 PDB entries)
  8. 2915398Domain d4p1la_: 4p1l A: [269257]
    automated match to d2hpga_
    complexed with bdp, gol, so4

Details for d4p1la_

PDB Entry: 4p1l (more details), 1.7 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound d-glucuronate, spg i213
PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4p1la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p1la_ c.94.1.0 (A:) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
swrgwnihppsypngkalesfakevaektegrvepkvyhnavlgdqpdaieqtrsgaldf
anfnmgpmgpivpaanvlslpfifkspddmyrimdgeigerfadalaeknlivlswfgsg
arslyntdhpvetpddveglkvrvmnndlyvqmidemggnatpmaygevyqslktgvidg
aennypsyessghyevanyysltehlilpeclcvakasweelsekdrqaireaaedaake
qralweegvqaskqkildagvkinevddksafqakmqpiydqfvqehpeleslvtdiqda
qs

SCOPe Domain Coordinates for d4p1la_:

Click to download the PDB-style file with coordinates for d4p1la_.
(The format of our PDB-style files is described here.)

Timeline for d4p1la_: