Lineage for d4ovpb_ (4ovp B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916201Species Sulfitobacter sp. [TaxId:314267] [267989] (3 PDB entries)
  8. 2916205Domain d4ovpb_: 4ovp B: [269255]
    automated match to d4pf8a_
    complexed with mav

Details for d4ovpb_

PDB Entry: 4ovp (more details), 1.7 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. nas-14.1, target efi-510292, with bound alpha-d- manuronate
PDB Compounds: (B:) C4-dicarboxylate transport system substrate-binding protein

SCOPe Domain Sequences for d4ovpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ovpb_ c.94.1.0 (B:) automated matches {Sulfitobacter sp. [TaxId: 314267]}
tvlrgasmfdeehaftktlrkfeelvdekydgdvtfdlrlngelgvesdyvtflnqgvai
dytilapsnmakfapsiplmdmpflfrdldhwnavlssdvlapledellekadikivgyt
gggtrnllskqpvvtfddlkghkmrvmgapiqaqifqaltaapsaiaynevynaiqtgvi
agfeneaasiqnlkfyevapnltltrhsitvrpivmsgktfnslpadlqavvleageeag
aygrelesredgvklqemvdagqltvsefenrdkmlemvkpvqdayaaeigasdlleavr
ak

SCOPe Domain Coordinates for d4ovpb_:

Click to download the PDB-style file with coordinates for d4ovpb_.
(The format of our PDB-style files is described here.)

Timeline for d4ovpb_: