Lineage for d4nx1b_ (4nx1 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2487255Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2487256Protein automated matches [190039] (145 species)
    not a true protein
  7. 2488146Species Sulfitobacter sp. [TaxId:314267] [267989] (3 PDB entries)
  8. 2488147Domain d4nx1b_: 4nx1 B: [269253]
    automated match to d4pf8a_
    complexed with x1x

Details for d4nx1b_

PDB Entry: 4nx1 (more details), 1.6 Å

PDB Description: Crystal structure of a trap periplasmic solute binding protein from Sulfitobacter sp. nas-14.1, target EFI-510292, with bound alpha-D-taluronate
PDB Compounds: (B:) C4-dicarboxylate transport system substrate-binding protein

SCOPe Domain Sequences for d4nx1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nx1b_ c.94.1.0 (B:) automated matches {Sulfitobacter sp. [TaxId: 314267]}
tvlrgasmfdeehaftktlrkfeelvdekydgdvtfdlrlngelgvesdyvtflnqgvai
dytilapsnmakfapsiplmdmpflfrdldhwnavlssdvlapledellekadikivgyt
gggtrnllskqpvvtfddlkghkmrvmgapiqaqifqaltaapsaiaynevynaiqtgvi
agfeneaasiqnlkfyevapnltltrhsitvrpivmsgktfnslpadlqavvleageeag
aygrelesredgvklqemvdagqltvsefenrdkmlemvkpvqdayaaeigasdlleavr
ak

SCOPe Domain Coordinates for d4nx1b_:

Click to download the PDB-style file with coordinates for d4nx1b_.
(The format of our PDB-style files is described here.)

Timeline for d4nx1b_: