Lineage for d4mj3b_ (4mj3 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2510015Species Mycobacterium rhodesiae [TaxId:931627] [269240] (1 PDB entry)
  8. 2510017Domain d4mj3b_: 4mj3 B: [269247]
    automated match to d2xt0a_
    complexed with cl, k

Details for d4mj3b_

PDB Entry: 4mj3 (more details), 1.7 Å

PDB Description: haloalkane dehalogenase dmra from mycobacterium rhodesiae js60
PDB Compounds: (B:) haloalkane dehalogenase

SCOPe Domain Sequences for d4mj3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mj3b_ c.69.1.0 (B:) automated matches {Mycobacterium rhodesiae [TaxId: 931627]}
mdvlrtpderftalpdfpfapryvevdsgdggtlrmhyldegrsdgevvlllhgepswsy
lyrwmipvlveaglravaidlvgfgrsdkptsrddytyqahvdwmwaaieeigladvtlv
cqdwggliglrlvgehpdrfarvvaantmlptgdhhpgeaflawqkfsqevplfpagqiv
nggslstlsaetiaaydapfpdasyqagarqfpmlvpispddpatpanrkawaalgrfek
pflsafsdsdpitgaaepvlrghvpgargqshvtiagaghflqedkgrelaeavvtfvra
npr

SCOPe Domain Coordinates for d4mj3b_:

Click to download the PDB-style file with coordinates for d4mj3b_.
(The format of our PDB-style files is described here.)

Timeline for d4mj3b_: