Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (124 species) not a true protein |
Species Mycobacterium rhodesiae [TaxId:931627] [269240] (1 PDB entry) |
Domain d4mj3d_: 4mj3 D: [269244] automated match to d2xt0a_ complexed with cl, k |
PDB Entry: 4mj3 (more details), 1.7 Å
SCOPe Domain Sequences for d4mj3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mj3d_ c.69.1.0 (D:) automated matches {Mycobacterium rhodesiae [TaxId: 931627]} mdvlrtpderftalpdfpfapryvevdsgdggtlrmhyldegrsdgevvlllhgepswsy lyrwmipvlveaglravaidlvgfgrsdkptsrddytyqahvdwmwaaieeigladvtlv cqdwggliglrlvgehpdrfarvvaantmlptgdhhpgeaflawqkfsqevplfpagqiv nggslstlsaetiaaydapfpdasyqagarqfpmlvpispddpatpanrkawaalgrfek pflsafsdsdpitgaaepvlrghvpgargqshvtiagaghflqedkgrelaeavvtfvra npr
Timeline for d4mj3d_: