Lineage for d4mj3d_ (4mj3 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902521Species Mycobacterium rhodesiae [TaxId:931627] [269240] (1 PDB entry)
  8. 2902525Domain d4mj3d_: 4mj3 D: [269244]
    automated match to d2xt0a_
    complexed with cl, k

Details for d4mj3d_

PDB Entry: 4mj3 (more details), 1.7 Å

PDB Description: haloalkane dehalogenase dmra from mycobacterium rhodesiae js60
PDB Compounds: (D:) haloalkane dehalogenase

SCOPe Domain Sequences for d4mj3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mj3d_ c.69.1.0 (D:) automated matches {Mycobacterium rhodesiae [TaxId: 931627]}
mdvlrtpderftalpdfpfapryvevdsgdggtlrmhyldegrsdgevvlllhgepswsy
lyrwmipvlveaglravaidlvgfgrsdkptsrddytyqahvdwmwaaieeigladvtlv
cqdwggliglrlvgehpdrfarvvaantmlptgdhhpgeaflawqkfsqevplfpagqiv
nggslstlsaetiaaydapfpdasyqagarqfpmlvpispddpatpanrkawaalgrfek
pflsafsdsdpitgaaepvlrghvpgargqshvtiagaghflqedkgrelaeavvtfvra
npr

SCOPe Domain Coordinates for d4mj3d_:

Click to download the PDB-style file with coordinates for d4mj3d_.
(The format of our PDB-style files is described here.)

Timeline for d4mj3d_: