Lineage for d1g8ja1 (1g8j A:683-825)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 113043Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
  4. 113057Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 113063Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (5 proteins)
  6. 113064Protein Arsenite oxidase large subunit [50704] (1 species)
  7. 113065Species Alcaligenes faecalis [TaxId:511] [50705] (2 PDB entries)
  8. 113070Domain d1g8ja1: 1g8j A:683-825 [26924]
    Other proteins in same PDB: d1g8ja2, d1g8jb_, d1g8jc2, d1g8jd_

Details for d1g8ja1

PDB Entry: 1g8j (more details), 2.03 Å

PDB Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis

SCOP Domain Sequences for d1g8ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8ja1 b.52.2.2 (A:683-825) Arsenite oxidase large subunit {Alcaligenes faecalis}
lpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqerypmayiemnpddckqldvtg
gdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgdvttdwtdrdiipyykgtwg
dirkvgsmsefkrtvsfksrrfg

SCOP Domain Coordinates for d1g8ja1:

Click to download the PDB-style file with coordinates for d1g8ja1.
(The format of our PDB-style files is described here.)

Timeline for d1g8ja1: