SCOPe 2.05: Domain d4xoxb1: 4xox B:1-249

Lineage for d4xoxb1 (4xox B:1-249)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (52 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:686] [269225] (1 PDB entry)

8. Domain d4xoxb1: 4xox B:1-249 [269226]
   automated match to d3mqda1

Details for d4xoxb1

PDB Entry: 4xox, 2.01 Å

PDB Description: structure of beta-ketoacyl-acp synthase i (fabb) from vibrio cholerae

PDB Compounds: (B:) 3-oxoacyl-ACP synthase

SCOPe Domain Sequences for d4xoxb1:

Sequence; same for both SEQRES and ATOM records:

>d4xoxb1 c.95.1.0 (B:1-249) automated matches {Vibrio cholerae [TaxId: 686]}
mkrvvitgmgiissignnveevlaslkagksgitaseqfkehglrsqvwgdlkinpeehi
drkqmrfmgdaaayaylsleqaiadagltpeqvsndrtgivagsggassenqviavdtqr
ekgvkrvgpymvprtmsstvsaclatpfkirgvnysissacatsahcignaveliqlgkq
divfagggeelywsqtmmfdamgalstkynetpekasrtydadrdgfvisggggmvvvee
lehalarga

Timeline for d4xoxb1:

• d4xoxb1 is new in SCOPe 2.05-stable
  
• d4xoxb1 appears in SCOPe 2.06
  
• d4xoxb1 appears in the current release, SCOPe 2.08