Lineage for d4xoxb1 (4xox B:1-249)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2918389Species Vibrio cholerae [TaxId:686] [269225] (1 PDB entry)
  8. 2918392Domain d4xoxb1: 4xox B:1-249 [269226]
    Other proteins in same PDB: d4xoxa3, d4xoxb3
    automated match to d3mqda1

Details for d4xoxb1

PDB Entry: 4xox (more details), 2.01 Å

PDB Description: structure of beta-ketoacyl-acp synthase i (fabb) from vibrio cholerae
PDB Compounds: (B:) 3-oxoacyl-ACP synthase

SCOPe Domain Sequences for d4xoxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xoxb1 c.95.1.0 (B:1-249) automated matches {Vibrio cholerae [TaxId: 686]}
mkrvvitgmgiissignnveevlaslkagksgitaseqfkehglrsqvwgdlkinpeehi
drkqmrfmgdaaayaylsleqaiadagltpeqvsndrtgivagsggassenqviavdtqr
ekgvkrvgpymvprtmsstvsaclatpfkirgvnysissacatsahcignaveliqlgkq
divfagggeelywsqtmmfdamgalstkynetpekasrtydadrdgfvisggggmvvvee
lehalarga

SCOPe Domain Coordinates for d4xoxb1:

Click to download the PDB-style file with coordinates for d4xoxb1.
(The format of our PDB-style files is described here.)

Timeline for d4xoxb1: