SCOPe 2.08: Domain d4xlta1: 4xlt A:1-129

Lineage for d4xlta1 (4xlt A:1-129)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Dyadobacter fermentans [TaxId:471854] [269223] (1 PDB entry)

8. Domain d4xlta1: 4xlt A:1-129 [269224]
   Other proteins in same PDB: d4xlta2
   automated match to d1k66a_

Details for d4xlta1

PDB Entry: 4xlt, 2.3 Å

PDB Description: Crystal structure of response regulator receiver protein from Dyadobacter fermentans DSM 18053

PDB Compounds: (A:) Response regulator receiver protein

SCOPe Domain Sequences for d4xlta1:

Sequence, based on SEQRES records:

>d4xlta1 c.23.1.0 (A:1-129) automated matches {Dyadobacter fermentans [TaxId: 471854]}
mdfiivddsvfdlftqeklllksglttsvrtfnsaqaaidhlrsqgadipdtvilldlqm
pgingfeftehygmlpeavrarirlfmisstvdisdieqaeanphiiqllpkpleipllr
ellkrwfps

Sequence, based on observed residues (ATOM records):

>d4xlta1 c.23.1.0 (A:1-129) automated matches {Dyadobacter fermentans [TaxId: 471854]}
mdfiivddsvfdlftqeklllksglttsvrtfnsaqaaidhlrsqgadipdtvilldlqm
ingfeftehygmlpeavrarirlfmisstvdisdieqaeanphiiqllpkpleipllrel
lkrwfps

Timeline for d4xlta1:

• d4xlta1 first appeared in SCOPe 2.05, called d4xlta_
  
• d4xlta1 appears in SCOPe 2.07