Lineage for d4xlta1 (4xlt A:1-129)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2101601Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2101973Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2101974Protein automated matches [190131] (71 species)
    not a true protein
  7. 2102065Species Dyadobacter fermentans [TaxId:471854] [269223] (1 PDB entry)
  8. 2102066Domain d4xlta1: 4xlt A:1-129 [269224]
    Other proteins in same PDB: d4xlta2
    automated match to d1k66a_

Details for d4xlta1

PDB Entry: 4xlt (more details), 2.3 Å

PDB Description: Crystal structure of response regulator receiver protein from Dyadobacter fermentans DSM 18053
PDB Compounds: (A:) Response regulator receiver protein

SCOPe Domain Sequences for d4xlta1:

Sequence, based on SEQRES records: (download)

>d4xlta1 c.23.1.0 (A:1-129) automated matches {Dyadobacter fermentans [TaxId: 471854]}
mdfiivddsvfdlftqeklllksglttsvrtfnsaqaaidhlrsqgadipdtvilldlqm
pgingfeftehygmlpeavrarirlfmisstvdisdieqaeanphiiqllpkpleipllr
ellkrwfps

Sequence, based on observed residues (ATOM records): (download)

>d4xlta1 c.23.1.0 (A:1-129) automated matches {Dyadobacter fermentans [TaxId: 471854]}
mdfiivddsvfdlftqeklllksglttsvrtfnsaqaaidhlrsqgadipdtvilldlqm
ingfeftehygmlpeavrarirlfmisstvdisdieqaeanphiiqllpkpleipllrel
lkrwfps

SCOPe Domain Coordinates for d4xlta1:

Click to download the PDB-style file with coordinates for d4xlta1.
(The format of our PDB-style files is described here.)

Timeline for d4xlta1:

  • d4xlta1 first appeared in SCOPe 2.05, called d4xlta_

View in 3D
Domains from same chain:
(mouse over for more information)
d4xlta2