Lineage for d1g8ke1 (1g8k E:683-825)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672755Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 672778Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 672802Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 672803Protein Arsenite oxidase large subunit [50704] (1 species)
  7. 672804Species Alcaligenes faecalis [TaxId:511] [50705] (2 PDB entries)
  8. 672807Domain d1g8ke1: 1g8k E:683-825 [26922]
    Other proteins in same PDB: d1g8ka2, d1g8kb_, d1g8kc2, d1g8kd_, d1g8ke2, d1g8kf_, d1g8kg2, d1g8kh_

Details for d1g8ke1

PDB Entry: 1g8k (more details), 1.64 Å

PDB Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis
PDB Compounds: (E:) arsenite oxidase

SCOP Domain Sequences for d1g8ke1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8ke1 b.52.2.2 (E:683-825) Arsenite oxidase large subunit {Alcaligenes faecalis [TaxId: 511]}
lpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqerypmayiemnpddckqldvtg
gdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgdvttdwtdrdiipyykgtwg
dirkvgsmsefkrtvsfksrrfg

SCOP Domain Coordinates for d1g8ke1:

Click to download the PDB-style file with coordinates for d1g8ke1.
(The format of our PDB-style files is described here.)

Timeline for d1g8ke1: