Lineage for d4xgha_ (4xgh A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004800Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2004801Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2004802Family a.103.1.1: Citrate synthase [48257] (2 protein domains)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2004868Protein automated matches [190675] (7 species)
    not a true protein
  7. 2004876Species Burkholderia thailandensis [TaxId:271848] [269215] (1 PDB entry)
  8. 2004877Domain d4xgha_: 4xgh A: [269216]
    automated match to d4jada_
    complexed with edo, so4

Details for d4xgha_

PDB Entry: 4xgh (more details), 2.1 Å

PDB Description: x-ray crystal structure of citrate synthase from burkholderia thailandensis
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d4xgha_:

Sequence, based on SEQRES records: (download)

>d4xgha_ a.103.1.1 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
dvkatlsfsdnspsvelpiykgtmgpdvidirklygqtgkftydpgfmstascnsaityi
dgdkgellyrgypidnlaqnadflescylllkgelpnaaqkkefvatvtkhtmvheqmqf
ffrgfrrdahpmailvaavgalsafyhdsldindprhrevsairmiaklptlvamaykys
igqpfvyprndlsysanfmrmmfanpceeykvndvlvraldrililhadheqnaststvr
lagssganpfaciaagiaclwgpahgganeaalnmleqigtpdnipefikqvkdknsgvk
lmgfghrvyknydpraklmretcyevlnelglhddplfklamqlekialedeyfvsrkly
pnvdfysgivqralgiptsmftcifamartvgwiaqwnemiadpeqkigrprqlfigetp
raakpidqr

Sequence, based on observed residues (ATOM records): (download)

>d4xgha_ a.103.1.1 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
dvkatlsfsdnspsvelpiykgtmgpdvidirklygqtgkftydpgfmstascnsaityi
dgdkgellyrgypidnlaqnadflescylllkgelpnaaqkkefvatvtkhtmvheqmqf
ffrgfrrdahpmailvaavgalsafyhdsdprhrevsairmiaklptlvamaykysigqp
fvyprndlsysanfmrmmfanpceeykvndvlvraldrililhadheqnaststvrlags
sganpfaciaagiaclwgpgganeaalnmleqigtpdnipefikydpraklmretcyevl
nelglhddplfklamqleklypnvdfysgivqralgiptsmftcifamartvgwiaqwne
miadpeqkigrprqlfigetpraakpidqr

SCOPe Domain Coordinates for d4xgha_:

Click to download the PDB-style file with coordinates for d4xgha_.
(The format of our PDB-style files is described here.)

Timeline for d4xgha_: