Lineage for d4xgia2 (4xgi A:198-434)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2454805Species Burkholderia thailandensis [TaxId:271848] [196827] (2 PDB entries)
  8. 2454816Domain d4xgia2: 4xgi A:198-434 [269210]
    Other proteins in same PDB: d4xgia1, d4xgib1, d4xgic1, d4xgid1, d4xgie1, d4xgif1
    automated match to d1euza1
    complexed with akg, edo, nad

Details for d4xgia2

PDB Entry: 4xgi (more details), 2 Å

PDB Description: crystal structure of glutamate dehydrogenase from burkholderia thailandensis
PDB Compounds: (A:) glutamate dehydrogenase

SCOPe Domain Sequences for d4xgia2:

Sequence, based on SEQRES records: (download)

>d4xgia2 c.2.1.0 (A:198-434) automated matches {Burkholderia thailandensis [TaxId: 271848]}
lggslgrkeatgrgvfvvgceaakkkgveiegariavqgfgnvggiaaklfqeagakvia
vqdhtgtihqpagvdtaklldhvgrtggvagfegaepmpndefwtveteilipaalenqi
teknaskirtkiivegangptttaaddilsangvlvipdvianaggvtvsyfewvqdfss
ffwtedeinhrlervmreafagvwavaeehkvsvrtaafivackrilmaremrglyp

Sequence, based on observed residues (ATOM records): (download)

>d4xgia2 c.2.1.0 (A:198-434) automated matches {Burkholderia thailandensis [TaxId: 271848]}
lggslgrkeatgrgvfvvgceaakkkgveiegariavqgfgnvggiaaklfqeagakvia
vqdhtgtihqpagvdtaklldhvgrtggvagfegaepmpndefwtveteilipaalenqi
teknaskirtkiivegangptttaaddilsangvlvipdvianaggvtvsyfewvqwted
einhrlervmreafagvwavaeehkvsvrtaafivackrilmaremrglyp

SCOPe Domain Coordinates for d4xgia2:

Click to download the PDB-style file with coordinates for d4xgia2.
(The format of our PDB-style files is described here.)

Timeline for d4xgia2: