Lineage for d1g8kc1 (1g8k C:683-825)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 231956Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 231975Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 231981Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (7 proteins)
    molybdopterine enzyme
  6. 231982Protein Arsenite oxidase large subunit [50704] (1 species)
  7. 231983Species Alcaligenes faecalis [TaxId:511] [50705] (2 PDB entries)
  8. 231985Domain d1g8kc1: 1g8k C:683-825 [26921]
    Other proteins in same PDB: d1g8ka2, d1g8kb_, d1g8kc2, d1g8kd_, d1g8ke2, d1g8kf_, d1g8kg2, d1g8kh_

Details for d1g8kc1

PDB Entry: 1g8k (more details), 1.64 Å

PDB Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis

SCOP Domain Sequences for d1g8kc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8kc1 b.52.2.2 (C:683-825) Arsenite oxidase large subunit {Alcaligenes faecalis}
lpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqerypmayiemnpddckqldvtg
gdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgdvttdwtdrdiipyykgtwg
dirkvgsmsefkrtvsfksrrfg

SCOP Domain Coordinates for d1g8kc1:

Click to download the PDB-style file with coordinates for d1g8kc1.
(The format of our PDB-style files is described here.)

Timeline for d1g8kc1: