| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
| Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
| Protein automated matches [226864] (29 species) not a true protein |
| Species Burkholderia thailandensis [TaxId:271848] [269204] (1 PDB entry) |
| Domain d4xgid1: 4xgi D:13-197 [269205] Other proteins in same PDB: d4xgia2, d4xgib2, d4xgic2, d4xgid2, d4xgie2, d4xgif2 automated match to d1euza2 complexed with akg, edo, nad |
PDB Entry: 4xgi (more details), 2 Å
SCOPe Domain Sequences for d4xgid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xgid1 c.58.1.0 (D:13-197) automated matches {Burkholderia thailandensis [TaxId: 271848]}
sipsylhaddlgpwgnylqqvdrvapylgslsrwietlkrpkrilivdvpieldngtvah
fegyrvqhnvsrgpgkggvryhqdvtlsevmalsawmsvknaavnvpyggakggirvdpr
klsrgelervtrrytseigiiigpntdipapdvntneqimawmmdtysmnqgqtatgvvt
gkpis
Timeline for d4xgid1: