| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (161 species) not a true protein |
| Species Pseudomonas putida [TaxId:231023] [269202] (1 PDB entry) |
| Domain d4xfea1: 4xfe A:25-323 [269203] Other proteins in same PDB: d4xfea2 automated match to d4n6da_ complexed with bdp, cxs, so4 |
PDB Entry: 4xfe (more details), 1.4 Å
SCOPe Domain Sequences for d4xfea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xfea1 c.94.1.0 (A:25-323) automated matches {Pseudomonas putida [TaxId: 231023]}
ldikfaeihpagyptvvaeqnmgkkleqasngditfkmfaggvlgsekevieqaqigavq
mtrvslgivgpvvpdvnvfnmpfvfrdhdhmrkiidgeigqeildkitnsdfnlvalawm
dggsrsiytkkpvrsledlkgmkirvqgnplfidmmnamggngiamdtgeifsalqtgvi
dgaennpptllehnhfqsakyytltghlilpepvvmskttwnkltpeqqvlvkkvareaq
meeralwdaksaaseeklkaagvefitvdkkpfydatasvrekygaqyadlmkridavq
Timeline for d4xfea1: