SCOPe 2.07: Domain d4xfea1: 4xfe A:25-323

Lineage for d4xfea1 (4xfe A:25-323)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (145 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:231023] [269202] (1 PDB entry)

8. Domain d4xfea1: 4xfe A:25-323 [269203]
   Other proteins in same PDB: d4xfea2
   automated match to d4n6da_
   complexed with bdp, cxs, so4

Details for d4xfea1

PDB Entry: 4xfe, 1.4 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate

PDB Compounds: (A:) TRAP dicarboxylate transporter subunit DctP

SCOPe Domain Sequences for d4xfea1:

Sequence; same for both SEQRES and ATOM records:

>d4xfea1 c.94.1.0 (A:25-323) automated matches {Pseudomonas putida [TaxId: 231023]}
ldikfaeihpagyptvvaeqnmgkkleqasngditfkmfaggvlgsekevieqaqigavq
mtrvslgivgpvvpdvnvfnmpfvfrdhdhmrkiidgeigqeildkitnsdfnlvalawm
dggsrsiytkkpvrsledlkgmkirvqgnplfidmmnamggngiamdtgeifsalqtgvi
dgaennpptllehnhfqsakyytltghlilpepvvmskttwnkltpeqqvlvkkvareaq
meeralwdaksaaseeklkaagvefitvdkkpfydatasvrekygaqyadlmkridavq

Timeline for d4xfea1:

• d4xfea1 first appeared in SCOPe 2.05, called d4xfea_
  
• d4xfea1 appears in SCOPe 2.06