Lineage for d4xfea1 (4xfe A:25-323)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916036Species Pseudomonas putida [TaxId:231023] [269202] (1 PDB entry)
  8. 2916037Domain d4xfea1: 4xfe A:25-323 [269203]
    Other proteins in same PDB: d4xfea2
    automated match to d4n6da_
    complexed with bdp, cxs, so4

Details for d4xfea1

PDB Entry: 4xfe (more details), 1.4 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
PDB Compounds: (A:) TRAP dicarboxylate transporter subunit DctP

SCOPe Domain Sequences for d4xfea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xfea1 c.94.1.0 (A:25-323) automated matches {Pseudomonas putida [TaxId: 231023]}
ldikfaeihpagyptvvaeqnmgkkleqasngditfkmfaggvlgsekevieqaqigavq
mtrvslgivgpvvpdvnvfnmpfvfrdhdhmrkiidgeigqeildkitnsdfnlvalawm
dggsrsiytkkpvrsledlkgmkirvqgnplfidmmnamggngiamdtgeifsalqtgvi
dgaennpptllehnhfqsakyytltghlilpepvvmskttwnkltpeqqvlvkkvareaq
meeralwdaksaaseeklkaagvefitvdkkpfydatasvrekygaqyadlmkridavq

SCOPe Domain Coordinates for d4xfea1:

Click to download the PDB-style file with coordinates for d4xfea1.
(The format of our PDB-style files is described here.)

Timeline for d4xfea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xfea2