Lineage for d4xfjb1 (4xfj B:2-172)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861542Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2861543Protein automated matches [190116] (28 species)
    not a true protein
  7. 2861634Species Mycobacterium thermoresistibile [TaxId:1078020] [260068] (2 PDB entries)
  8. 2861636Domain d4xfjb1: 4xfj B:2-172 [269195]
    Other proteins in same PDB: d4xfja2, d4xfjb2
    automated match to d4u7ja1
    complexed with anp, arg, edo, mg

Details for d4xfjb1

PDB Entry: 4xfj (more details), 1.55 Å

PDB Description: crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine
PDB Compounds: (B:) argininosuccinate synthase

SCOPe Domain Sequences for d4xfjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xfjb1 c.26.2.0 (B:2-172) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
servilaysggldtsvaiswigketgrevvavaidlgqggedmevvrqraldcgavesiv
idardefandycvpaiqsnalymdryplvsalsrplivkhlvkaarehggtivahgctgk
gndqvrfevgfaslapdlevlapvrdyawtrekaiafaeennipinvtkrs

SCOPe Domain Coordinates for d4xfjb1:

Click to download the PDB-style file with coordinates for d4xfjb1.
(The format of our PDB-style files is described here.)

Timeline for d4xfjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xfjb2