SCOPe 2.06: Domain d1tmoa1: 1tmo A:632-798

Lineage for d1tmoa1 (1tmo A:632-798)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
   molybdopterine enzyme

6. Protein Trimethylamine N-oxide reductase [50702] (1 species)

7. Species Shewanella massilia [TaxId:76854] [50703] (1 PDB entry)

8. Domain d1tmoa1: 1tmo A:632-798 [26919]
   Other proteins in same PDB: d1tmoa2
   complexed with 2md, 2mo

Details for d1tmoa1

PDB Entry: 1tmo, 2.5 Å

PDB Description: trimethylamine n-oxide reductase from shewanella massilia

PDB Compounds: (A:) trimethylamine n-oxide reductase

SCOPe Domain Sequences for d1tmoa1:

Sequence; same for both SEQRES and ATOM records:

>d1tmoa1 b.52.2.2 (A:632-798) Trimethylamine N-oxide reductase {Shewanella massilia [TaxId: 76854]}
ershggpgsdkhpiwlqschpdkrlhsqmcesreyretyavngrepvyispvdakargik
dgdivrvfndrgqllagavvsdnfpkgivrihegawygpvgkdgsteggaevgalcsygd
pntltldigtsklaqacsaytclvefekyqgkvpkvssfdgpievei

Timeline for d1tmoa1:

• d1tmoa1 first appeared (with stable ids) in SCOP 1.55, called d1tmo_1
  
• d1tmoa1 appears in SCOPe 2.05
  
• d1tmoa1 appears in SCOPe 2.07
  
• d1tmoa1 appears in the current release, SCOPe 2.08