Lineage for d1tmo_1 (1tmo 632-798)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 169434Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
  4. 169448Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 169454Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (6 proteins)
  6. 169493Protein Trimethylamine N-oxide reductase [50702] (1 species)
  7. 169494Species Shewanella massilia [TaxId:76854] [50703] (1 PDB entry)
  8. 169495Domain d1tmo_1: 1tmo 632-798 [26919]
    Other proteins in same PDB: d1tmo_2

Details for d1tmo_1

PDB Entry: 1tmo (more details), 2.5 Å

PDB Description: trimethylamine n-oxide reductase from shewanella massilia

SCOP Domain Sequences for d1tmo_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tmo_1 b.52.2.2 (632-798) Trimethylamine N-oxide reductase {Shewanella massilia}
ershggpgsdkhpiwlqschpdkrlhsqmcesreyretyavngrepvyispvdakargik
dgdivrvfndrgqllagavvsdnfpkgivrihegawygpvgkdgsteggaevgalcsygd
pntltldigtsklaqacsaytclvefekyqgkvpkvssfdgpievei

SCOP Domain Coordinates for d1tmo_1:

Click to download the PDB-style file with coordinates for d1tmo_1.
(The format of our PDB-style files is described here.)

Timeline for d1tmo_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tmo_2