Lineage for d1tmo_1 (1tmo 632-798)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) Superfamily b.52.2: ADC-like [50692] (3 families) 
Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (5 proteins) 
Protein Trimethylamine N-oxide reductase [50702] (1 species) Species Shewanella massilia [TaxId:76854] [50703] (1 PDB entry) 
Domain d1tmo_1: 1tmo 632-798 [26919]
Other proteins in same PDB: d1tmo_2
Details for d1tmo_1
PDB Entry: 1tmo (more details), 2.5 Å
PDB Description: trimethylamine n-oxide reductase from shewanella massilia
SCOP Domain Sequences for d1tmo_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tmo_1 b.52.2.2 (632-798) Trimethylamine N-oxide reductase {Shewanella massilia}
ershggpgsdkhpiwlqschpdkrlhsqmcesreyretyavngrepvyispvdakargik
dgdivrvfndrgqllagavvsdnfpkgivrihegawygpvgkdgsteggaevgalcsygd
pntltldigtsklaqacsaytclvefekyqgkvpkvssfdgpievei
SCOP Domain Coordinates for d1tmo_1:
Click to download the PDB-style file with coordinates for d1tmo_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tmo_1:
- d1tmo_1 first appeared (with stable ids) in SCOP 1.55
- d1tmo_1 appears in SCOP 1.59
- d1tmo_1 appears in the current release, SCOPe 2.08, called d1tmoa1
View in 3D
